FOXL1 Antibody - middle region : HRP

FOXL1 Antibody - middle region : HRP
SKU
AVIARP57981_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of FOXL1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXL1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Forkhead box protein L1

Protein Size: 345

Purification: Affinity Purified
More Information
SKU AVIARP57981_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57981_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2300
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×