FOXN3 Antibody - middle region : FITC

FOXN3 Antibody - middle region : FITC
SKU
AVIARP57855_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FOXN3 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXN3

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Forkhead box protein N3

Protein Size: 468

Purification: Affinity Purified
More Information
SKU AVIARP57855_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57855_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1112
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×