Frg1 Antibody - middle region : Biotin

Frg1 Antibody - middle region : Biotin
SKU
AVIARP54731_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Frg1 may have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits and also may be involved in pre-mRNA splicing

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FRG1

Protein Size: 258

Purification: Affinity Purified
More Information
SKU AVIARP54731_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54731_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 14300
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×