FRMD3 Antibody - N-terminal region : Biotin

FRMD3 Antibody - N-terminal region : Biotin
SKU
AVIARP55726_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a single pass membrane protein primarily found in ovaries. A similar protein in erythrocytes helps determine the shape of red blood cells, but the function of the encoded protein has not been determined. There is some evidence that this is a tumor suppressor gene, and there is also evidence linking defects in this gene to susceptibility to diabetic nephropathy in type 1 diabetes. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN FRMD3

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: GACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FERM domain-containing protein 3

Protein Size: 553

Purification: Affinity Purified
More Information
SKU AVIARP55726_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55726_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257019
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×