FRZB Antibody - middle region : Biotin

FRZB Antibody - middle region : Biotin
SKU
AVIARP54571_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FRZB

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secreted frizzled-related protein 3

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP54571_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54571_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2487
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×