FSCN3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: FSCN3 acts as an actin bundling protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FSCN3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fascin-3

Protein Size: 498

Purification: Affinity Purified

• SKU: AVIARP53741_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53741_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29999
• Host: Rabbit
• Conjugate: Conjugated, Biotin