FSTL5 Antibody - middle region : Biotin

FSTL5 Antibody - middle region : Biotin
SKU
AVIARP57354_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FSTL5

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Follistatin-related protein 5

Protein Size: 837

Purification: Affinity Purified
More Information
SKU AVIARP57354_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57354_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56884
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×