FUCA1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognized in man: that in tissues, FUCA1, which is deficient in

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FUCA1

Key Reference: Venditti,J.J., (2007) Mol. Reprod. Dev. 74 (6), 758-766

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tissue alpha-L-fucosidase

Protein Size: 466

Purification: Affinity Purified

• SKU: AVIARP54294_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54294_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2517
• Host: Rabbit
• Conjugate: Conjugated, FITC