FYN Antibody - N-terminal region : Biotin

FYN Antibody - N-terminal region : Biotin
SKU
AVIARP55567_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN

Key Reference: Hoe,H.S., (2008) J. Biol. Chem. 283 (10), 6288-6299

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Fyn

Protein Size: 482

Purification: Affinity Purified
More Information
SKU AVIARP55567_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55567_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2534
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×