GBP2 Antibody - N-terminal region : FITC

GBP2 Antibody - N-terminal region : FITC
SKU
AVIARP54715_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced guanylate-binding protein 2

Protein Size: 591

Purification: Affinity Purified
More Information
SKU AVIARP54715_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54715_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2634
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×