GCFC2 Antibody - N-terminal region : FITC

GCFC2 Antibody - N-terminal region : FITC
SKU
AVIARP58089_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCFC2

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GC-rich sequence DNA-binding factor 2

Protein Size: 781

Purification: Affinity Purified
More Information
SKU AVIARP58089_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58089_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6936
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×