Gfap Antibody - N-terminal region : FITC

Gfap Antibody - N-terminal region : FITC
SKU
AVIARP54621_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glial fibrillary acidic protein

Protein Size: 418

Purification: Affinity Purified
More Information
SKU AVIARP54621_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54621_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 14580
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×