GGA3 Antibody - N-terminal region : HRP

GGA3 Antibody - N-terminal region : HRP
SKU
AVIARP55423_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GGA3

Key Reference: Wang,J., (2007) Mol. Biol. Cell 18 (7), 2646-2655

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-binding protein GGA3

Protein Size: 723

Purification: Affinity Purified
More Information
SKU AVIARP55423_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55423_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23163
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×