GK2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GK2

Key Reference: Sargent,C.A., (1994) Hum. Mol. Genet. 3 (8), 1317-1324

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glycerol kinase 2

Protein Size: 553

Purification: Affinity Purified

• SKU: AVIARP53815_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53815_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2712
• Host: Rabbit
• Conjugate: Conjugated, HRP