GK2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GK2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol kinase 2

Protein Size: 553

Purification: Affinity Purified

• SKU: AVIARP53814_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53814_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2712
• Host: Rabbit
• Conjugate: Conjugated, FITC