GLOD4 Antibody - middle region : Biotin

GLOD4 Antibody - middle region : Biotin
SKU
AVIARP56829_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLOD4

Key Reference: Zhang,H.T., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (8), 747-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyoxalase domain-containing protein 4

Protein Size: 298

Purification: Affinity Purified
More Information
SKU AVIARP56829_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56829_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51031
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×