GLOD4 Antibody - N-terminal region : Biotin

GLOD4 Antibody - N-terminal region : Biotin
SKU
AVIARP56828_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of GLOD4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLOD4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyoxalase domain-containing protein 4

Protein Size: 298

Purification: Affinity Purified
More Information
SKU AVIARP56828_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56828_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51031
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×