GLRX Antibody - N-terminal region : HRP

GLRX Antibody - N-terminal region : HRP
SKU
AVIARP54626_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX

Key Reference: Prinarakis,E., (2008) EMBO J. 27 (6), 865-875

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-1

Protein Size: 106

Purification: Affinity Purified
More Information
SKU AVIARP54626_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54626_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2745
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×