GLS Antibody - C-terminal region : HRP

GLS Antibody - C-terminal region : HRP
SKU
AVIARP55098_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS

Key Reference: Sahai (1983) [PubMed 6825316]

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaminase kidney isoform, mitochondrial

Protein Size: 669

Purification: Affinity Purified
More Information
SKU AVIARP55098_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55098_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2744
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×