GNA12 Antibody - C-terminal region : HRP

GNA12 Antibody - C-terminal region : HRP
SKU
AVIARP54814_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GNA12

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein subunit alpha-12 Ensembl ENSP00000385935

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP54814_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54814_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2768
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×