GNAO1 Antibody - middle region : Biotin

GNAO1 Antibody - middle region : Biotin
SKU
AVIARP55425_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAO1

Key Reference: Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ31446 fis, clone NT2NE2000909, highly similar to Guanine nucleotide-binding protein G(o) subunit alpha 1 EMBL BAG51601.1

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP55425_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55425_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2775
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×