Gnaq Antibody - middle region : HRP

Gnaq Antibody - middle region : HRP
SKU
AVIARP54636_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gnaq may mediate cardiomyocyte growth and hypertrophy; overexpression may facilitate apoptosis by inhibiting the PI3K/phosphoinositide-dependent kinase-1/Akt cell survival signaling pathway.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP54636_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54636_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 81666
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×