GNB1 Antibody - N-terminal region : Biotin

GNB1 Antibody - N-terminal region : Biotin
SKU
AVIARP54637_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a bet

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1

Key Reference: Ueda,H., (2008) J. Biol. Chem. 283 (4), 1946-1953

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

Protein Size: 340

Purification: Affinity Purified

Subunit: beta-1
More Information
SKU AVIARP54637_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54637_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2782
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×