GNB4 Antibody - middle region : Biotin

GNB4 Antibody - middle region : Biotin
SKU
AVIARP57549_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNB4

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit beta-4

Protein Size: 340

Purification: Affinity Purified

Specificity#: Gene Symbol:GNB1,GNB2,GNB3
Protein Accession#:NP_002065,NP_005264,NP_002066
Nucleotide Accession#:NM_002074,NM_005273,NM_002075
Swissprot ID:P62873,P62879,P16520


Subunit: beta1-4
More Information
SKU AVIARP57549_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57549_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 59345
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×