GNGT2 Antibody - middle region : HRP

GNGT2 Antibody - middle region : HRP
SKU
AVIARP55401_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNGT2

Key Reference: DePuy,S.D., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (39), 14590-14595

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Protein Size: 69

Purification: Affinity Purified

Subunit: gamma-T2
More Information
SKU AVIARP55401_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55401_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2793
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×