GNRH2 Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Molecular Weight: 13 kDa

Peptide Sequence: Synthetic peptide located within the following region: SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Progonadoliberin-2

Protein Size: 120

Purification: Affinity Purified

• SKU: AVIARP55770_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55770_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Human Gene ID: 2797
• Host: Rabbit
• Conjugate: Conjugated, FITC