GPS1 Antibody - N-terminal region : FITC

GPS1 Antibody - N-terminal region : FITC
SKU
AVIARP57999_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: VQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COP9 signalosome complex subunit 1

Protein Size: 491

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP57999_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57999_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2873
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×