GRK4 Antibody - middle region : Biotin

GRK4 Antibody - middle region : Biotin
SKU
AVIARP53565_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRK4

Key Reference: Staessen,J.A., (er) Hypertension (2008) In press

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G protein-coupled receptor kinase 4

Protein Size: 532

Purification: Affinity Purified
More Information
SKU AVIARP53565_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53565_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2868
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×