GRK4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRK4

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: G protein-coupled receptor kinase 4

Protein Size: 546

Purification: Affinity Purified

• SKU: AVIARP53566_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53566_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2868
• Host: Rabbit
• Conjugate: Conjugated, HRP