GRK5 Antibody - C-terminal region : Biotin

GRK5 Antibody - C-terminal region : Biotin
SKU
AVIARP54751_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GRK5

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G protein-coupled receptor kinase 5

Protein Size: 485

Purification: Affinity Purified
More Information
SKU AVIARP54751_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54751_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2869
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×