GSG1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSG1

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Germ cell-specific gene 1 protein

Protein Size: 362

Purification: Affinity Purified

• SKU: AVIARP53801_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53801_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 83445
• Host: Rabbit
• Conjugate: Conjugated, HRP