GTF2A1 Antibody - N-terminal region : FITC

GTF2A1 Antibody - N-terminal region : FITC
SKU
AVIARP58154_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GTF2A1 belongs to the TFIIA subunit 1 family. It is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. This protein induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2A1

Key Reference: Hieb,A.R., (2007) J. Mol. Biol. 372 (3), 619-632

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 376

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP58154_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58154_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2957
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×