Gtf2h5 Antibody - N-terminal region : FITC

Gtf2h5 Antibody - N-terminal region : FITC
SKU
AVIARP55987_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gtf2h5 is a component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. It is necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: General transcription factor IIH subunit 5

Protein Size: 71

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP55987_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55987_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 66467
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×