Guf1 Antibody - C-terminal region : FITC

Guf1 Antibody - C-terminal region : FITC
SKU
AVIARP57564_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Guf1 promotes mitochondrial protein synthesis. It may act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. It binds to mitochondrial ribosomes in a GTP-dependent manner.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Translation factor Guf1, mitochondrial

Protein Size: 651

Purification: Affinity Purified
More Information
SKU AVIARP57564_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57564_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 231279
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×