GUK1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GUK1 is essential for recycling GMP and indirectly, cGMP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GUK1

Key Reference: Brady,W.A., (1996) J. Biol. Chem. 271 (28), 16734-16740

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanylate kinase

Protein Size: 197

Purification: Affinity Purified

• SKU: AVIARP54358_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54358_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2987
• Host: Rabbit
• Conjugate: Conjugated, FITC