HAGH Antibody - C-terminal region : HRP

HAGH Antibody - C-terminal region : HRP
SKU
AVIARP54514_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAGH

Key Reference: Xu,Y. (2006) J. Biol. Chem. 281 (36), 26702-26713

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hydroxyacylglutathione hydrolase, mitochondrial

Protein Size: 260

Purification: Affinity Purified
More Information
SKU AVIARP54514_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54514_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3029
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×