HAPLN2 Antibody - middle region : Biotin

HAPLN2 Antibody - middle region : Biotin
SKU
AVIARP57560_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAPLN2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hyaluronan and proteoglycan link protein 2

Protein Size: 340

Purification: Affinity Purified
More Information
SKU AVIARP57560_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57560_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60484
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×