HAPLN2 Antibody - middle region : HRP

HAPLN2 Antibody - middle region : HRP
SKU
AVIARP57560_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAPLN2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hyaluronan and proteoglycan link protein 2

Protein Size: 340

Purification: Affinity Purified
More Information
SKU AVIARP57560_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57560_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60484
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×