Hbe1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epsilon 1 globin EMBL CAA39765.1

Protein Size: 147

Purification: Affinity Purified

• SKU: AVIARP54319_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54319_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 293267
• Host: Rabbit
• Conjugate: Conjugated, Biotin