HEMGN Antibody - N-terminal region : HRP

HEMGN Antibody - N-terminal region : HRP
SKU
AVIARP57794_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEMGN

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hemogen

Protein Size: 484

Purification: Affinity Purified
More Information
SKU AVIARP57794_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57794_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55363
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×