HEPACAM Antibody - N-terminal region : Biotin

HEPACAM Antibody - N-terminal region : Biotin
SKU
AVIARP55503_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LOW QUALITY PROTEIN: hepatocyte cell adhesion molecule; hepatocyte cell adhesion molecule

Protein Size: 307

Purification: Affinity Purified
More Information
SKU AVIARP55503_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55503_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 300517
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×