HEPACAM Antibody - N-terminal region : Biotin

HEPACAM Antibody - N-terminal region : Biotin
SKU
AVIARP55504_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEPACAM

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hepatocyte cell adhesion molecule

Protein Size: 416

Purification: Affinity Purified
More Information
SKU AVIARP55504_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55504_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220296
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×