HEPACAM Antibody - N-terminal region : HRP

HEPACAM Antibody - N-terminal region : HRP
SKU
AVIARP55504_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEPACAM

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatocyte cell adhesion molecule

Protein Size: 416

Purification: Affinity Purified
More Information
SKU AVIARP55504_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55504_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220296
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×