HINT1 Antibody - N-terminal region : HRP

HINT1 Antibody - N-terminal region : HRP
SKU
AVIARP54767_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1

Key Reference: Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histidine triad nucleotide-binding protein 1

Protein Size: 126

Purification: Affinity Purified
More Information
SKU AVIARP54767_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54767_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3094
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×