HIRIP3 Antibody - middle region : Biotin

HIRIP3 Antibody - middle region : Biotin
SKU
AVIARP58286_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIRIP3

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HIRA-interacting protein 3

Protein Size: 556

Purification: Affinity Purified
More Information
SKU AVIARP58286_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58286_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8479
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×