HIST2H2BF Antibody - N-terminal region : Biotin

HIST2H2BF Antibody - N-terminal region : Biotin
SKU
AVIARP56220_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF

Key Reference: Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone H2B type 2-F

Protein Size: 126

Purification: Affinity Purified
More Information
SKU AVIARP56220_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56220_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 440689
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×