Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 2-130(end)
Amino Acid Sequence: MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC
Application: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Description: Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol
Genbank: NM_033445
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag, Biotin
Uniprot: Q7L7L0
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Osley, M.A. Brief Funct. Genomic
Proteomic 5(3):179-89 (2006).
2. Wyrick, J.J. and Parra, M.A. Biochim
Biophys Acta. 1789(1):37-44 (2009).
3. Zhou, W., et al. Int J Biochem Cell Biol.
41(1):12-5 (2009).