HK2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HK2

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hexokinase-2

Protein Size: 917

Purification: Affinity Purified

• SKU: AVIARP54304_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54304_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3099
• Host: Rabbit
• Conjugate: Conjugated, FITC