HMBS Antibody - N-terminal region : FITC

HMBS Antibody - N-terminal region : FITC
SKU
AVIARP54451_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBS

Key Reference: Kuo,H.C., J. Neurol. Sci. 260 (1-2), 231-235 (2007)

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Porphobilinogen deaminase

Protein Size: 344

Purification: Affinity Purified
More Information
SKU AVIARP54451_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54451_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3145
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×