HMGCLL1 Antibody - N-terminal region : Biotin

HMGCLL1 Antibody - N-terminal region : Biotin
SKU
AVIARP56277_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCLL1

Key Reference: Mitchell,G.A., (1993) J. Biol. Chem. 268 (6), 4376-4381

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic

Protein Size: 340

Purification: Affinity Purified
More Information
SKU AVIARP56277_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56277_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54511
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×